Recombinant Human DDX39B Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | DDX39B-4297H |
Product Overview : | BAT1 MS Standard C13 and N15-labeled recombinant protein (NP_542165) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the DEAD box family of RNA-dependent ATPases that mediate ATP hydrolysis during pre-mRNA splicing. The encoded protein is an essential splicing factor required for association of U2 small nuclear ribonucleoprotein with pre-mRNA, and it also plays an important role in mRNA export from the nucleus to the cytoplasm. This gene belongs to a cluster of genes localized in the vicinity of the genes encoding tumor necrosis factor alpha and tumor necrosis factor beta. These genes are all within the human major histocompatibility complex class III region. Mutations in this gene may be associated with rheumatoid arthritis. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on both chromosomes 6 and 11. Read-through transcription also occurs between this gene and the upstream ATP6V1G2 (ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G2) gene. |
Molecular Mass : | 49 kDa |
AA Sequence : | MAENDVDNELLDYEDDEVETAAGGDGAEAPAKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIVVGTPGRILALARNKSLNLKHIKHFILDECDKMLEQLDMRRDVQEIFRMTPHEKQVMMFSATLSKEIRPVCRKFMQDPMEIFVDDETKLTLHGLQQYYVKLKDNEKNRKLFDLLDVLEFNQVVIFVKSVQRCIALAQLLVEQNFPAIAIHRGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSYIEQTRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | DDX39B DExD-box helicase 39B [ Homo sapiens (human) ] |
Official Symbol | DDX39B |
Synonyms | DDX39B; DEAD (Asp-Glu-Ala-Asp) box polypeptide 39B; BAT1, HLA B associated transcript 1; spliceosome RNA helicase DDX39B; D6S81E; U2AF65 associated protein 56; UAP56; spliceosome RNA helicase BAT1; ATP-dependent RNA helicase p47; 56 kDa U2AF65-associated protein; nuclear RNA helicase (DEAD family); HLA-B-associated transcript 1 protein; BAT1; |
Gene ID | 7919 |
mRNA Refseq | NM_080598 |
Protein Refseq | NP_542165 |
MIM | 142560 |
UniProt ID | Q13838 |
◆ Recombinant Proteins | ||
DDX39B-2272M | Recombinant Mouse DDX39B Protein, His (Fc)-Avi-tagged | +Inquiry |
DDX39B-1820HF | Recombinant Full Length Human DDX39B Protein, GST-tagged | +Inquiry |
DDX39B-2519H | Recombinant Human DDX39B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
DDX39B-12225Z | Recombinant Zebrafish DDX39B | +Inquiry |
DDX39B-5139H | Recombinant Human DDX39B protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DDX39B-8512HCL | Recombinant Human BAT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DDX39B Products
Required fields are marked with *
My Review for All DDX39B Products
Required fields are marked with *
0
Inquiry Basket