Recombinant Human DDT Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: DDT-3434H
• Product Overview: DDT MS Standard C13 and N15-labeled recombinant protein (NP_001346) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: D-dopachrome tautomerase converts D-dopachrome into 5,6-dihydroxyindole. The DDT gene is related to the migration inhibitory factor (MIF) in terms of sequence, enzyme activity, and gene structure. DDT and MIF are closely linked on chromosome 22.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 12.7 kDa
• AA Sequence: MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: DDT D-dopachrome tautomerase [ Homo sapiens (human) ]
• Official Symbol: DDT
• Synonyms: DDT; D-dopachrome tautomerase; D-dopachrome decarboxylase; D dopachrome decarboxylase; DDCT; phenylpyruvate tautomerase II; FLJ78842
• Gene ID: 1652
• mRNA Refseq: NM_001355
• Protein Refseq: NP_001346
• MIM: 602750
• UniProt ID: P30046