Recombinant Human DCX, His-tagged

Cat.No. : DCX-26890TH
Product Overview : Recombinant full length protein, corresponding to amino acids 1-365 of Human Doublecortin with N terminal His tag, 47kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-365 a.a.
Description : This gene encodes a member of the doublecortin family. The protein encoded by this gene is a cytoplasmic protein and contains two doublecortin domains, which bind microtubules. In the developing cortex, cortical neurons must migrate over long distances to reach the site of their final differentiation. The encoded protein appears to direct neuronal migration by regulating the organization and stability of microtubules. In addition, the encoded protein interacts with LIS1, the regulatory gamma subunit of platelet activating factor acetylhydrolase, and this interaction is important to proper microtubule function in the developing cortex. Mutations in this gene cause abnormal migration of neurons during development and disrupt the layering of the cortex, leading to epilepsy, mental retardation, subcortical band heterotopia ("double cortex" syndrome) in females and lissencephaly ("smooth brain" syndrome) in males. Multiple transcript variants encoding different isoforms have been found for this gene.
Conjugation : HIS
Tissue specificity : Highly expressed in neuronal cells of fetal brain (in the majority of cells of the cortical plate, intermediate zone and ventricular zone), but not expressed in other fetal tissues. In the adult, highly expressed in the brain frontal lobe, but very low ex
Form : Lyophilised:Reconstitute with 83 μl distilled water.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MELDFGHFDERDKTSRNMRGSRMNGLPSPTHSAHCSFYRT RTLQALSNEKKAKKVRFYRNGDRYFKGIVYAVSSDRFR SFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSM DELEEGESYVCSSDNFFKKVEYTKNVNPNWSVNVKTSANM KAPQSLASSNSAQARENKDFVRPKLVTIIRSGVKPRKA VRVLLNKKTAHSFEQVLTDITEAIKLETGVVKKLYTLD GKQVTCLHDFFGDDDVFIACGPEKFRYAQDDFSLDENECRVMKGNPSATAGPKASPTPQKTSAKSPGPMRRSKSPADS GNDQDANGTSSSQLSTPKSKQSPISTPTSPGSLRKHKD LYLPLSLDDSDSLGDSM
Sequence Similarities : Contains 2 doublecortin domains.
Full Length : Full L.
Gene Name DCX doublecortin [ Homo sapiens ]
Official Symbol DCX
Synonyms DCX; doublecortin; doublecortex; lissencephaly, X linked (doublecortin); neuronal migration protein doublecortin; DBCN; DC; doublecortex; LISX; SCLH; XLIS;
Gene ID 1641
mRNA Refseq NM_000555
Protein Refseq NP_000546
MIM 300121
Uniprot ID O43602
Chromosome Location Xq22.3-q23
Pathway Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; L1CAM interactions, organism-specific biosystem; Lissencephaly gene (LIS1) in neuronal migration and development, organism-specific biosystem; Neurofascin interactions, organism-specific biosystem;
Function microtubule binding; protein kinase binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DCX Products

Required fields are marked with *

My Review for All DCX Products

Required fields are marked with *

0

Inquiry Basket

cartIcon