Recombinant Human DCUN1D5 Protein, GST-tagged

Cat.No. : DCUN1D5-2422H
Product Overview : Human DCUN1D5 full-length ORF ( NP_115675.1, 1 a.a. - 237 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : DCUN1D5 (Defective In Cullin Neddylation 1 Domain Containing 5) is a Protein Coding gene. An important paralog of this gene is DCUN1D4.
Molecular Mass : 53.9 kDa
AA Sequence : MPVKKKRKSPGVAAAVAEDGGLKKCKISSYCRSQPPARLISGEEHFSSKKCLAWFYEYAGPDEVVGPEGMEKFCEDIGVEPENIIMLVLAWKLEAESMGFFTKEEWLKGMTSLQCDCTEKLQNKFDFLRSQLNDISSFKNIYRYAFDFARDKDQRSLDIDTAKSMLALLLGRTWPLFSVFYQYLEQSKYRVMNKDQWYNVLEFSRTVHADLSNYDEDGAWPVLLDEFVEWQKVRQTS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DCUN1D5 DCN1, defective in cullin neddylation 1, domain containing 5 (S. cerevisiae) [ Homo sapiens ]
Official Symbol DCUN1D5
Synonyms DCN1, defective in cullin neddylation 1, domain containing 5 (S. cerevisiae); Defective in cullin neddylation protein 1-like protein 5; FLJ32431; MGC2714; DCN1-like protein 5; DCUN1D5
Gene ID 84259
mRNA Refseq NM_032299.3
Protein Refseq NP_115675.1
MIM 616522
UniProt ID Q9BTE7

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All DCUN1D5 Products

Required fields are marked with *

My Review for All DCUN1D5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon