Recombinant Human DARC Protein, GST-tagged

• Cat.No.: DARC-4582H
• Product Overview: Human FY full-length ORF ( AAH17817, 1 a.a. - 336 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene is a glycosylated membrane protein and a non-specific receptor for several chemokines. The encoded protein is the receptor for the human malarial parasites Plasmodium vivax and Plasmodium knowlesi. Polymorphisms in this gene are the basis of the Duffy blood group system. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 62.7 kDa
• AA Sequence: MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLSMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLPLPEGWFSHLDTLGSKS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DARC Duffy blood group, chemokine receptor [ Homo sapiens ]
• Official Symbol: DARC
• Synonyms: DARC; Duffy blood group, chemokine receptor; Duffy blood group, FY; Duffy antigen/chemokine receptor; CCBP1; CD234; Dfy; GPD; glycoprotein D; Fy glycoprotein; Duffy blood group antigen; plasmodium vivax receptor; FY; GpFy; WBCQ1
• Gene ID: 2532
• mRNA Refseq: NM_001122951
• Protein Refseq: NP_001116423
• MIM: 613665
• UniProt ID: Q16570