Recombinant Human CYTL1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CYTL1-1442H
• Product Overview: CYTL1 MS Standard C13 and N15-labeled recombinant protein (NP_061129) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: C17 is a cytokine-like protein specifically expressed in bone marrow and cord blood mononuclear cells that bear the CD34 surface marker.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 15.6 kDa
• AA Sequence: MRTPGPLPVLLLLLAGAPAARPTPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDRQRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CYTL1 cytokine like 1 [ Homo sapiens (human) ]
• Official Symbol: CYTL1
• Synonyms: CYTL1; cytokine like 1; C17; C4orf4; cytokine-like protein 1; cytokine-like protein C17
• Gene ID: 54360
• mRNA Refseq: NM_018659
• Protein Refseq: NP_061129
• MIM: 607930
• UniProt ID: Q9NRR1