Recombinant Human CYSTM1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CYSTM1-2692H
• Product Overview: C5orf32 MS Standard C13 and N15-labeled recombinant protein (NP_115788) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: CYSTM1 (Cysteine Rich Transmembrane Module Containing 1) is a Protein Coding gene. Diseases associated with CYSTM1 include Sengers Syndrome. Among its related pathways are Innate Immune System.
• Molecular Mass: 10.6 kDa
• AA Sequence: MNQENPPPYPGPGPTAPYPPYPPQPMGPGPMGGPYPPPQGYPYQGYPQYGWQGGPQEPPKTTVYVVEDQRRDELGPSTCLTACWTALCCSCLWDMLTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CYSTM1 cysteine rich transmembrane module containing 1 [ Homo sapiens (human) ]
• Official Symbol: CYSTM1
• Synonyms: CYSTM1; cysteine rich transmembrane module containing 1; C5orf32; ORF1-FL49; cysteine-rich and transmembrane domain-containing protein 1; UPF0467 protein C5orf32; putative nuclear protein ORF1-FL49
• Gene ID: 84418
• mRNA Refseq: NM_032412
• Protein Refseq: NP_115788
• UniProt ID: Q9H1C7