Recombinant Human CXXC5 protein, GST-tagged

• Cat.No.: CXXC5-27H
• Product Overview: Recombinant Human CXXC5(1 a.a. - 227 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• ProteinLength: 1 a.a. - 227 a.a.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 50.5 kDa
• AA Sequence: MMGGESADKATAAAAAASLLANGHDLAAAMAVDKSNPTSKHKSGAVASLLSKAERATELAAEGQLTLQQFAQSTE MLKRVVQEHLPLMSEAGAGLPDMEAVAGAEALNGQSDFPYLGAFPINPGLFIMTPAGVFLAESALHMAGLAEYPM QGELASAISSGKKKRKRCGMCAPCRRRINCEQCSSCRNRKTGHQICKFRKCEELKKKPSAALEKVMLPTGAAFRW FQ
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: CXXC5 CXXC finger protein 5 [ Homo sapiens ]
• Official Symbol: CXXC5
• Synonyms: CF5; WID; RINF; HSPC195
• Gene ID: 51523
• mRNA Refseq: NM_016463.7
• Protein Refseq: NP_057547
• MIM: 612752
• UniProt ID: Q7LFL8
• Chromosome Location: 5q31.2
• Function: DNA binding;signal transducer activity;zinc ion binding