Recombinant Human CXCR4 Protein, His-SUMO/MYC-tagged

• Cat.No.: CXCR4-1175H
• Product Overview: Recombinant Human CXCR4 Protein (303-352aa) was expressed in E. coli with N-terminal 10XHis-SUMO and C-terminal MYC-tag.

Specification

• Source: E. coli
• Species: Human
• Tag: His&Myc&SUMO
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 25.2 kDa
• AA Sequence: PILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSS
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Protein length: 303-352 a.a.

Gene Information

• Gene Name: CXCR4 chemokine (C-X-C motif) receptor 4 [ Homo sapiens ]
• Official Symbol: CXCR4
• Synonyms: CXCR4; chemokine (C-X-C motif) receptor 4; chemokine (C X C motif), receptor 4 (fusin); C-X-C chemokine receptor type 4; CD184; D2S201E; fusin; HM89; HSY3RR; LESTR; NPY3R; NPYR; NPYY3R; CXC-R4; CXCR-4; CD184 antigen; SDF-1 receptor; neuropeptide Y receptor Y3; seven transmembrane helix receptor; stromal cell-derived factor 1 receptor; lipopolysaccharide-associated protein 3; seven-transmembrane-segment receptor, spleen; leukocyte-derived seven transmembrane domain receptor; leukocyte-derived seven-transmembrane-domain receptor; FB22; LAP3; LCR1; WHIM; NPYRL
• Gene ID: 7852
• mRNA Refseq: NM_001008540
• Protein Refseq: NP_001008540
• MIM: 162643
• UniProt ID: P61073