Recombinant Human CXCL2, StrepII-tagged

• Cat.No.: CXCL2-282H
• Product Overview: Purified, full-length human recombinant GRO-beta (CXCL2) protein (amino acids 35-107, 73 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 7.9 kDa. (Accession NP_002080.1; UniProt P19875)

Specification

• Description: GRO-beta belongs to the intercine alpha (CXC chemokine) family. It is produced by activated monocytes and neutrophils and expressed at sites of inflammation. GRO-beta is available as an immunomodulator and is used prior to hematopoetic transplantation for peripheral blood stem cell mobilization and reduction of incidence, duration, and/or severity of chemotherapy-induced cytopenias.
• Source: Human Cells
• Species: Human
• Tag: StrepII
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free)
• Protein length: 35-107, 73 a.a.
• AA Sequence: APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
• Endotoxin: <0.1 eu per μg protein by lal
• Purity: >90% by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml

Gene Information

• Gene Name: CXCL2 chemokine (C-X-C motif) ligand 2 [ Homo sapiens ]
• Official Symbol: CXCL2
• Synonyms: CXCL2; chemokine (C-X-C motif) ligand 2; GRO2, GRO2 oncogene; C-X-C motif chemokine 2; CINC 2a; GROb; MGSA b; MIP 2a; SCYB2; gro-beta; MGSA beta; MIP2-alpha; GRO2 oncogene; growth-regulated protein beta; macrophage inflammatory protein 2-alpha; melanoma growth stimulatory activity beta; GRO2; MIP2; MIP2A; MGSA-b; MIP-2a; CINC-2a
• Gene ID: 2920
• mRNA Refseq: NM_002089
• Protein Refseq: NP_002080
• MIM: 139110
• UniProt ID: P19875
• Chromosome Location: 4q13.3
• Pathway: Chemokine receptors bind chemokines, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Cytokines and Inflammatory Response, organism-specific biosystem
• Function: chemokine activity