Recombinant Human CXCL2, StrepII-tagged

Cat.No. : CXCL2-282H
Product Overview : Purified, full-length human recombinant GRO-beta (CXCL2) protein (amino acids 35-107, 73 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 7.9 kDa. (Accession NP_002080.1; UniProt P19875)
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : Strep II
Protein Length : 35-107, 73 a.a.
Description : GRO-beta belongs to the intercine alpha (CXC chemokine) family. It is produced by activated monocytes and neutrophils and expressed at sites of inflammation. GRO-beta is available as an immunomodulator and is used prior to hematopoetic transplantation for peripheral blood stem cell mobilization and reduction of incidence, duration, and/or severity of chemotherapy-induced cytopenias.
Form : Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free)
AA Sequence : APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
Endotoxin : <0.1 eu per μg protein by lal
Purity : >90% by SDS-PAGE
Storage : 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles
Reconstitution : Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml
Gene Name CXCL2 chemokine (C-X-C motif) ligand 2 [ Homo sapiens ]
Official Symbol CXCL2
Synonyms CXCL2; chemokine (C-X-C motif) ligand 2; GRO2, GRO2 oncogene; C-X-C motif chemokine 2; CINC 2a; GROb; MGSA b; MIP 2a; SCYB2; gro-beta; MGSA beta; MIP2-alpha; GRO2 oncogene; growth-regulated protein beta; macrophage inflammatory protein 2-alpha; melanoma growth stimulatory activity beta; GRO2; MIP2; MIP2A; MGSA-b; MIP-2a; CINC-2a;
Gene ID 2920
mRNA Refseq NM_002089
Protein Refseq NP_002080
MIM 139110
UniProt ID P19875
Chromosome Location 4q13.3
Pathway Chemokine receptors bind chemokines, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Cytokines and Inflammatory Response, organism-specific biosystem;
Function chemokine activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CXCL2 Products

Required fields are marked with *

My Review for All CXCL2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon