Recombinant Human CXCL2, StrepII-tagged
Cat.No. : | CXCL2-282H |
Product Overview : | Purified, full-length human recombinant GRO-beta (CXCL2) protein (amino acids 35-107, 73 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 7.9 kDa. (Accession NP_002080.1; UniProt P19875) |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Strep II |
Protein Length : | 35-107, 73 a.a. |
Description : | GRO-beta belongs to the intercine alpha (CXC chemokine) family. It is produced by activated monocytes and neutrophils and expressed at sites of inflammation. GRO-beta is available as an immunomodulator and is used prior to hematopoetic transplantation for peripheral blood stem cell mobilization and reduction of incidence, duration, and/or severity of chemotherapy-induced cytopenias. |
Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free) |
AA Sequence : | APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN |
Endotoxin : | <0.1 eu per μg protein by lal |
Purity : | >90% by SDS-PAGE |
Storage : | 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles |
Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml |
Gene Name | CXCL2 chemokine (C-X-C motif) ligand 2 [ Homo sapiens ] |
Official Symbol | CXCL2 |
Synonyms | CXCL2; chemokine (C-X-C motif) ligand 2; GRO2, GRO2 oncogene; C-X-C motif chemokine 2; CINC 2a; GROb; MGSA b; MIP 2a; SCYB2; gro-beta; MGSA beta; MIP2-alpha; GRO2 oncogene; growth-regulated protein beta; macrophage inflammatory protein 2-alpha; melanoma growth stimulatory activity beta; GRO2; MIP2; MIP2A; MGSA-b; MIP-2a; CINC-2a; |
Gene ID | 2920 |
mRNA Refseq | NM_002089 |
Protein Refseq | NP_002080 |
MIM | 139110 |
UniProt ID | P19875 |
Chromosome Location | 4q13.3 |
Pathway | Chemokine receptors bind chemokines, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Cytokines and Inflammatory Response, organism-specific biosystem; |
Function | chemokine activity; |
◆ Recombinant Proteins | ||
CXCL2-2100H | Recombinant Human CXCL2 Protein (Thr39-Asn107), C-His tagged | +Inquiry |
Cxcl2-2395M | Active Recombinant Mouse Cxcl2 Protein | +Inquiry |
CXCL2-65M | Recombinant Mouse CXCL2 Protein | +Inquiry |
CXCL2-2097M | Recombinant Mouse CXCL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CXCL2-224H | Recombinant Human chemokine (C-X-C motif) ligand 2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL2-7168HCL | Recombinant Human CXCL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CXCL2 Products
Required fields are marked with *
My Review for All CXCL2 Products
Required fields are marked with *
0
Inquiry Basket