Recombinant Human CXCL2 Protein

• Cat.No.: CXCL2-64H
• Product Overview: Recombinant Human CXCL2 Protein without tag was expressed in E. coli.

Specification

• Description: Growth regulated protein beta (GRO-β), also known as CXCL2, is a chemokine that is secreted by macrophages, neutrophils, and monocytes at sites of inflammation. GRO-β functions as a chemoattractant for leukocytes and hematopoietic stem cells. GRO-β activity is mediated through binding the G-protein-coupled chemokine receptor CXCR2.
• Source: E. coli
• Species: Human
• Bio-activity: No biological activity data is available at this time.
• Molecular Mass: Monomer, 7.9 kDa (73 aa)
• AA Sequence: APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
• Endotoxin: ≤1 EUs/μg, Kinetic LAL
• Purity: ≥95%, Reducing and Non-Reducing SDS PAGE
• Stability: 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
  1 month when stored at 4 centigrade after reconstituting as directed.
  3 months when stored at -20 to -80 centigrade after reconstituting as directed.
• Storage: Storage Prior to Reconstitution: -20 centigrade
• Storage Buffer: Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
• Reconstitution: Sterile water at 0.1 mg/mL
• Shipping: Room temperature
• Instructions: Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.

Gene Information

• Gene Name: CXCL2 chemokine (C-X-C motif) ligand 2 [ Homo sapiens (human) ]
• Official Symbol: CXCL2
• Synonyms: CXCL2; chemokine (C-X-C motif) ligand 2; GRO2, GRO2 oncogene; C-X-C motif chemokine 2; CINC 2a; GROb; MGSA b; MIP 2a; SCYB2; gro-beta; MGSA beta; MIP2-alpha; GRO2 oncogene; growth-regulated protein beta; macrophage inflammatory protein 2-alpha; melanoma growth stimulatory activity beta; GRO2; MIP2; MIP2A; MGSA-b; MIP-2a; CINC-2a
• Gene ID: 2920
• mRNA Refseq: NM_002089
• Protein Refseq: NP_002080
• MIM: 139110
• UniProt ID: P19875