Recombinant Human CXCL17 Protein, His tagged

Cat.No. : CXCL17-872H
Product Overview : Recombinant Human CXCL17 Protein with His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : The protein encoded by this gene is a mucosal chemokine that attracts immature dendritic cells and blood monocytes to the lungs. The encoded protein also promotes tumorigenesis through an angiogenic activity. Finally, this protein exhibits strong antimicrobial activity against E. coli, S. aureus, Salmonella, P. aeruginosa, and C. albicans. Two transcript variants, one protein-coding and the other non-protein coding, have been found for this gene.
Molecular Mass : The protein has a calculated MW of 14 kDa.
AA Sequence : MGSSHHHHHHSSGLVPRGSHMSSLNPGVARGHRDRGQASRRWLQEGGQECECKDWFLRAPRRKFMTVSGLPKKQCPCDHFKGNVKKTRHQRHHRKPNKHSRACQQFLKQCQLRSFALPL
Endotoxin : < 1 EU/μg by LAL
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 1 mg/mL by BCA
Storage Buffer : Sterile PBS, pH 7.4
Gene Name CXCL17 chemokine (C-X-C motif) ligand 17 [ Homo sapiens ]
Official Symbol CXCL17
Synonyms CXCL17; chemokine (C-X-C motif) ligand 17; VEGF co-regulated chemokine 1; Dcip1; DMC; UNQ473; VCC1; C-X-C motif chemokine 17; dendritic cell and monocyte chemokine-like protein; VCC-1; MGC138300;
Gene ID 284340
mRNA Refseq NM_198477
Protein Refseq NP_940879
MIM 611387
UniProt ID Q6UXB2

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CXCL17 Products

Required fields are marked with *

My Review for All CXCL17 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon