Recombinant Human CXCL17 Protein, His tagged

• Cat.No.: CXCL17-872H
• Product Overview: Recombinant Human CXCL17 Protein with His tag was expressed in E. coli.

Specification

• Description: The protein encoded by this gene is a mucosal chemokine that attracts immature dendritic cells and blood monocytes to the lungs. The encoded protein also promotes tumorigenesis through an angiogenic activity. Finally, this protein exhibits strong antimicrobial activity against E. coli, S. aureus, Salmonella, P. aeruginosa, and C. albicans. Two transcript variants, one protein-coding and the other non-protein coding, have been found for this gene.
• Source: E. coli
• Species: Human
• Tag: His
• Molecular Mass: The protein has a calculated MW of 14 kDa.
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMSSLNPGVARGHRDRGQASRRWLQEGGQECECKDWFLRAPRRKFMTVSGLPKKQCPCDHFKGNVKKTRHQRHHRKPNKHSRACQQFLKQCQLRSFALPL
• Endotoxin: < 1 EU/μg by LAL
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 1 mg/mL by BCA
• Storage Buffer: Sterile PBS, pH 7.4

Gene Information

• Gene Name: CXCL17 chemokine (C-X-C motif) ligand 17 [ Homo sapiens ]
• Official Symbol: CXCL17
• Synonyms: CXCL17; chemokine (C-X-C motif) ligand 17; VEGF co-regulated chemokine 1; Dcip1; DMC; UNQ473; VCC1; C-X-C motif chemokine 17; dendritic cell and monocyte chemokine-like protein; VCC-1; MGC138300
• Gene ID: 284340
• mRNA Refseq: NM_198477
• Protein Refseq: NP_940879
• MIM: 611387
• UniProt ID: Q6UXB2