Recombinant Human CUTA Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CUTA-4849H |
Product Overview : | CUTA MS Standard C13 and N15-labeled recombinant protein (NP_001014837) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Description : | May form part of a complex of membrane proteins attached to acetylcholinesterase (AChE). |
Molecular Mass : | 16.8 kDa |
AA Sequence : | MPALLPVASRLLLLPRVLLTMASGSPPTQPSPASDSGSGYVPGSVSAAFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVLMMIKTQSSLVPALTDFVRSVHPYEVAEVIALPVEQGNFPYLQWVRQVTESVSDSITVLPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CUTA cutA divalent cation tolerance homolog [ Homo sapiens (human) ] |
Official Symbol | CUTA |
Synonyms | CUTA; cutA divalent cation tolerance homolog (E. coli); acetylcholinesterase associated protein, ACHAP, C6orf82, chromosome 6 open reading frame 82; protein CutA; divalent cation tolerant protein CUTA; acetylcholinesterase-associated protein; brain acetylcholinesterase putative membrane anchor; ACHAP; C6orf82; MGC111154; |
Gene ID | 51596 |
mRNA Refseq | NM_001014837 |
Protein Refseq | NP_001014837 |
MIM | 616953 |
UniProt ID | O60888 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All CUTA Products
Required fields are marked with *
My Review for All CUTA Products
Required fields are marked with *
0
Inquiry Basket