Recombinant Human CUL1 protein, His-tagged
Cat.No. : | CUL1-2239H |
Product Overview : | Recombinant Human CUL1 protein(363-533 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 363-533 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4, 17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Samples are stable for up to twelve months from date of receipt at -20°C to -80°C. Store it under sterile conditions at -20°C to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | PKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPELLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSASDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDL |
Gene Name | CUL1 cullin 1 [ Homo sapiens ] |
Official Symbol | CUL1 |
Synonyms | CUL1; cullin 1; cullin-1; CUL-1; MGC149834; MGC149835; |
Gene ID | 8454 |
mRNA Refseq | NM_003592 |
Protein Refseq | NP_003583 |
MIM | 603134 |
UniProt ID | Q13616 |
◆ Recombinant Proteins | ||
CUL1-688H | Recombinant Human CUL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CUL1-1332H | Recombinant Human CUL1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CUL1-3189H | Recombinant Human CUL1 protein, His-tagged | +Inquiry |
Cul1-2374M | Recombinant Mouse Cul1 Protein, Myc/DDK-tagged | +Inquiry |
CUL1-4075M | Recombinant Mouse CUL1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CUL1-7185HCL | Recombinant Human CUL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CUL1 Products
Required fields are marked with *
My Review for All CUL1 Products
Required fields are marked with *
0
Inquiry Basket