Recombinant Human CUL1, His-tagged
Cat.No. : | CUL1-28050TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 525-776 of Human Cullin 1 with N terminal His tag; Predicted MWt 30 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 525-776 a.a. |
Description : | Cullin1, also known CUL1, is a core component of multiple cullin-RING-based SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complexes, which mediate the ubiquitination of proteins involved in cell cycle progression, signal transduction and tran |
Conjugation : | HIS |
Tissue specificity : | Expressed in lung fibroblasts. |
Form : | Lyophilised:Reconstitute with 83 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | LTNSEPLDLDFSIQVLSSGSWPFQQSCTFALPSELERSYQ RFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYTLQ ASTFQMAILLQYNTEDAYTVQQLTDSTQIKMDILAQVL QILLKSKLLVLEDENANVDEVELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRI MKMRKVLKHQQLLGEVLTQLSSRFKPRVPVIKKCIDIL IEKEYLERVDGEKDTYSYLA |
Sequence Similarities : | Belongs to the cullin family. |
Gene Name | CUL1 cullin 1 [ Homo sapiens ] |
Official Symbol | CUL1 |
Synonyms | CUL1; cullin 1; cullin-1; |
Gene ID | 8454 |
mRNA Refseq | NM_003592 |
Protein Refseq | NP_003583 |
MIM | 603134 |
Uniprot ID | Q13616 |
Chromosome Location | 7q36.1 |
Pathway | APC/C-mediated degradation of cell cycle proteins, organism-specific biosystem; Adaptive Immune System, organism-specific biosystem; Antigen processing: Ubiquitination & Proteasome degradation, organism-specific biosystem; Canonical Wnt signaling pathway, organism-specific biosystem; |
Function | protein binding; ubiquitin protein ligase binding; |
◆ Recombinant Proteins | ||
CUL1-4075M | Recombinant Mouse CUL1 Protein | +Inquiry |
CUL1-147H | Active Recombinant Human CUL1/RBX1/SKP1 | +Inquiry |
CUL1-26258TH | Recombinant Human CUL1 protein, His-tagged | +Inquiry |
Cul1-2374M | Recombinant Mouse Cul1 Protein, Myc/DDK-tagged | +Inquiry |
CUL1-688H | Recombinant Human CUL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CUL1-7185HCL | Recombinant Human CUL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CUL1 Products
Required fields are marked with *
My Review for All CUL1 Products
Required fields are marked with *
0
Inquiry Basket