Recombinant Human CUEDC2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CUEDC2-5282H
• Product Overview: CUEDC2 MS Standard C13 and N15-labeled recombinant protein (NP_076945) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Down-regulates ESR1 protein levels through the ubiquitination-proteasome pathway, regardless of the presence of 17 beta-estradiol. Also involved in 17 beta-estradiol-induced ESR1 degradation. Controls PGR protein levels through a similar mechanism.
• Molecular Mass: 24.7 kDa
• AA Sequence: MELERIVSAALLAFVQTHLPEADLSGLDEVIFSYVLGVLEDLGPSGPSEENFDMEAFTEMMEAYVPGFAHIPRGTIGDMMQKLSGQLSDARNKENLQPQSSGVQGQVPISPEPLQRPEMLKEETRSSAAAAADTQDEATGAEEELLPGVDVLLEVFPTCSVEQAQWVLAKARGDLEEAVQMLVEGKEEGPAAWEGPNQDLPRRLRGPQKDELKSFILQKYMMVDSATRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CUEDC2 CUE domain containing 2 [ Homo sapiens (human) ]
• Official Symbol: CUEDC2
• Synonyms: CUEDC2; CUE domain containing 2; C10orf66; bA18I14.5; CUE domain-containing protein 2
• Gene ID: 79004
• mRNA Refseq: NM_024040
• Protein Refseq: NP_076945
• MIM: 614142
• UniProt ID: Q9H467