Recombinant Human CTHRC1 protein, His&Myc-tagged

• Cat.No.: CTHRC1-5710H
• Product Overview: Recombinant Human CTHRC1 protein(31-243aa)(Q96CG8), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc
• Protein Length: 31-243aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 30.5 kDa
• AA Sequence: SEIPKGKQKAQLRQREVVDLYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPEMNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: CTHRC1 collagen triple helix repeat containing 1 [ Homo sapiens ]
• Official Symbol: CTHRC1
• Synonyms: CTHRC1; collagen triple helix repeat containing 1; collagen triple helix repeat-containing protein 1
• Gene ID: 115908
• mRNA Refseq: NM_001256099
• Protein Refseq: NP_001243028
• MIM: 610635
• UniProt ID: Q96CG8