Recombinant Human CTF1, StrepII-tagged

• Cat.No.: CTF1-251H
• Product Overview: Purified, full-length human recombinant CTF1 or Cardiotrophin 1protein (amino acids 1-201, 201 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 21.1 kDa. (Accession NP_001321.1; UniProt Q16619)

Specification

• Description: CTF1 is a secreted cytokine that induces cardiac myocyte hypertrophy in vitro. It has been shown to bind and activate the ILST/gp130 receoptor.
• Source: Human Cells
• Species: Human
• Tag: StrepII
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
• Protein length: 1-201, 201 a.a.
• AA Sequence: SRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPL LDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA
• Endotoxin: <0.1 eu per ug protein by lal
• Purity: ~80% pure by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.

Gene Information

• Gene Name: CTF1 cardiotrophin 1 [ Homo sapiens ]
• Official Symbol: CTF1
• Synonyms: CTF1; cardiotrophin 1; cardiotrophin-1; CT 1; CT1; cardiophin 1; CT-1
• Gene ID: 1489
• mRNA Refseq: NM_001142544
• Protein Refseq: NP_001136016
• MIM: 600435
• UniProt ID: Q16619
• Chromosome Location: 16p11.2
• Pathway: Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem; MicroRNAs in cardiomyocyte hypertrophy, organism-specific biosystem
• Function: cytokine activity; leukemia inhibitory factor receptor binding