Recombinant Human CSRP2 Protein, GST-tagged

• Cat.No.: CSRP2-2019H
• Product Overview: Human CSRP2 full-length ORF ( AAH00992, 1 a.a. - 193 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: CSRP2 is a member of the CSRP family of genes, encoding a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. CRP2 contains two copies of the cysteine-rich amino acid sequence motif (LIM) with putative zinc-binding activity, and may be involved in regulating ordered cell growth. Other genes in the family include CSRP1 and CSRP3. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]
• Molecular Mass: 46.97 kDa
• AA Sequence: MPVWGGGNKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTVAIHDEEIYCKSCYGKKYGPKGYGYGQGAGTLNMDRGERLGIKPESVQPHRPTTNPNTSKFAQKYGGAEKCSRCGDSVYAAEKIIGAGKPWHKNCFRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CSRP2 cysteine and glycine-rich protein 2 [ Homo sapiens ]
• Official Symbol: CSRP2
• Synonyms: CSRP2; cysteine and glycine-rich protein 2; CRP2; LMO5; SmLIM; LMO-5; cysteine-rich protein 2; LIM domain only protein 5; smooth muscle cell LIM protein; LIM domain only 5, smooth muscle
• Gene ID: 1466
• mRNA Refseq: NM_001321
• Protein Refseq: NP_001312
• MIM: 601871
• UniProt ID: Q16527