Recombinant Human CSRP1 protein, GST-tagged
Cat.No. : | CSRP1-301572H |
Product Overview : | Recombinant Human CSRP1 (1-193 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Glu193 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKSCYGKKYGPKGYGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWHKACFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHSE |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | CSRP1 cysteine and glycine-rich protein 1 [ Homo sapiens ] |
Official Symbol | CSRP1 |
Synonyms | CSRP1; cysteine and glycine-rich protein 1; CYRP; CSRP; D1S181E; LIM-domain protein; cysteine-rich protein 1; CRP; CRP1; DKFZp686M148; |
Gene ID | 1465 |
mRNA Refseq | NM_001193570 |
Protein Refseq | NP_001180499 |
MIM | 123876 |
UniProt ID | P21291 |
◆ Recombinant Proteins | ||
CSRP1-891R | Recombinant Rhesus Macaque CSRP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Csrp1-2343M | Recombinant Mouse Csrp1 Protein, Myc/DDK-tagged | +Inquiry |
Csrp1-6916M | Recombinant Mouse CSRP1 protein(Met1-Glu193), His-tagged | +Inquiry |
CSRP1-6681H | Recombinant Human CSRP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CSRP1-28020TH | Recombinant Human CSRP1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSRP1-7233HCL | Recombinant Human CSRP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CSRP1 Products
Required fields are marked with *
My Review for All CSRP1 Products
Required fields are marked with *
0
Inquiry Basket