Recombinant Human CSRP1 protein, GST-tagged

• Cat.No.: CSRP1-301572H
• Product Overview: Recombinant Human CSRP1 (1-193 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• ProteinLength: Met1-Glu193
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKSCYGKKYGPKGYGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWHKACFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHSE
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: CSRP1 cysteine and glycine-rich protein 1 [ Homo sapiens ]
• Official Symbol: CSRP1
• Synonyms: CSRP1; cysteine and glycine-rich protein 1; CYRP; CSRP; D1S181E; LIM-domain protein; cysteine-rich protein 1; CRP; CRP1; DKFZp686M148
• Gene ID: 1465
• mRNA Refseq: NM_001193570
• Protein Refseq: NP_001180499
• MIM: 123876
• UniProt ID: P21291