Recombinant Human CSNK2B Protein

Cat.No. : CSNK2B-08H
Product Overview : Recombinant human CK2beta (1-215aa) without tag was expressed in E. coli and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes the beta subunit of casein kinase II, a ubiquitous protein kinase which regulates metabolic pathways, signal transduction, transcription, translation, and replication. The enzyme is composed of three subunits, alpha, alpha prime and beta, which form a tetrameric holoenzyme. The alpha and alpha prime subunits are catalytic, while the beta subunit serves regulatory functions. The enzyme localizes to the endoplasmic reticulum and the Golgi apparatus. Two transcript variants encoding different isoforms have been found for this gene.
Source : E.coli
Species : Human
Form : Liquid
Molecular Mass : 24.9 kDa confirmed by MALDI-TOF
Identity : 215aa
AA Sequence : MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR
Purity : > 95% by SDS-PAGE
Applications : SDS-PAGE
Storage : Can be stored at 2 to 8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 1 mg/mL (determined by Bradford assay)
Storage Buffer : 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 0.2M NaCl, 1mM DTT, 1mM EDTA
Protein length : 1-215 a.a.
Gene Name CSNK2B casein kinase 2 beta [ Homo sapiens (human) ]
Official Symbol CSNK2B
Synonyms CSNK2B; casein kinase 2 beta; G5A; CK2B; CK2N; Ckb1; Ckb2; CSK2B; POBINDS; casein kinase II subunit beta; CK II beta; CSNK2B-LY6G5B-1072; CSNK2B-LY6G5B-1103; CSNK2B-LY6G5B-532; CSNK2B-LY6G5B-560; CSNK2B-LY6G5B-562; Casein kinase II beta subunit; alternative name: G5a, phosvitin; casein kinase 2, beta polypeptide; phosvitin; protein G5a; EC 2.7.11.1
Gene ID 1460
mRNA Refseq NM_001320
Protein Refseq NP_001311
MIM 115441
UniProt ID P67870

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CSNK2B Products

Required fields are marked with *

My Review for All CSNK2B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon