Recombinant Human CSNK2B Protein
Cat.No. : | CSNK2B-08H |
Product Overview : | Recombinant human CK2beta (1-215aa) without tag was expressed in E. coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 1-215 a.a. |
Description : | This gene encodes the beta subunit of casein kinase II, a ubiquitous protein kinase which regulates metabolic pathways, signal transduction, transcription, translation, and replication. The enzyme is composed of three subunits, alpha, alpha prime and beta, which form a tetrameric holoenzyme. The alpha and alpha prime subunits are catalytic, while the beta subunit serves regulatory functions. The enzyme localizes to the endoplasmic reticulum and the Golgi apparatus. Two transcript variants encoding different isoforms have been found for this gene. |
Form : | Liquid |
Molecular Mass : | 24.9 kDa confirmed by MALDI-TOF |
Identity : | 215aa |
AA Sequence : | MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR |
Purity : | > 95% by SDS-PAGE |
Applications : | SDS-PAGE |
Storage : | Can be stored at 2 to 8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 1 mg/mL (determined by Bradford assay) |
Storage Buffer : | 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 0.2M NaCl, 1mM DTT, 1mM EDTA |
Gene Name | CSNK2B casein kinase 2 beta [ Homo sapiens (human) ] |
Official Symbol | CSNK2B |
Synonyms | CSNK2B; casein kinase 2 beta; G5A; CK2B; CK2N; Ckb1; Ckb2; CSK2B; POBINDS; casein kinase II subunit beta; CK II beta; CSNK2B-LY6G5B-1072; CSNK2B-LY6G5B-1103; CSNK2B-LY6G5B-532; CSNK2B-LY6G5B-560; CSNK2B-LY6G5B-562; Casein kinase II beta subunit; alternative name: G5a, phosvitin; casein kinase 2, beta polypeptide; phosvitin; protein G5a; EC 2.7.11.1 |
Gene ID | 1460 |
mRNA Refseq | NM_001320 |
Protein Refseq | NP_001311 |
MIM | 115441 |
UniProt ID | P67870 |
◆ Recombinant Proteins | ||
CSNK2B-1638R | Recombinant Rat CSNK2B Protein | +Inquiry |
CSNK2B-11635H | Recombinant Human CSNK2B protein, His-tagged | +Inquiry |
CSNK2B-8792Z | Recombinant Zebrafish CSNK2B | +Inquiry |
CSNK2B-1296R | Recombinant Rat CSNK2B Protein, His (Fc)-Avi-tagged | +Inquiry |
CSNK2B-2024M | Recombinant Mouse CSNK2B Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSNK2B-7237HCL | Recombinant Human CSNK2B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CSNK2B Products
Required fields are marked with *
My Review for All CSNK2B Products
Required fields are marked with *
0
Inquiry Basket