Recombinant Human CSNK2A2 Protein, GST-tagged

• Cat.No.: CSNK2A2-2010H
• Product Overview: Human CSNK2A2 full-length ORF ( AAH08812.1, 1 a.a. - 350 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes the alpha', or alpha 2, catalytic subunit of the protein kinase enzyme, casein kinase 2 (CK2). Casein kinase 2 is a serine/threonine protein kinase that phosphorylates acidic proteins such as casein. It is involved in various cellular processes, including cell cycle control, apoptosis, and circadian rhythms. This heterotetrameric kinase includes two catalytic subunits, either alpha or alpha', and two regulatory beta subunits. The closely related gene paralog encoding the alpha, or alpha 1 subunit (CSNK2A1, Gene ID: 1457) is found on chromosome 20. An intronic variant in this gene (alpha 2) may be associated with leukocyte telomere length in a South Asian population. A related transcribed pseudogene is found on chromosome 11. [provided by RefSeq, Aug 2017]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 64.13 kDa
• AA Sequence: MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRREPFFHGQDNYDQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR
• Applications: Kinase Assay
  Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CSNK2A2 casein kinase 2, alpha prime polypeptide [ Homo sapiens ]
• Official Symbol: CSNK2A2
• Synonyms: CSNK2A2; casein kinase 2, alpha prime polypeptide; casein kinase II subunit alpha; CSNK2A1; CK II alpha; CK2A2; FLJ43934
• Gene ID: 1459
• mRNA Refseq: NM_001896
• Protein Refseq: NP_001887
• MIM: 115442
• UniProt ID: P19784