Recombinant Human CSNK1G1 Protein, GST-tagged

• Cat.No.: CSNK1G1-1998H
• Product Overview: Human CSNK1G1 partial ORF ( AAH17236, 293 a.a. - 393 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of the casein kinase I gene family. This family is comprised of serine/threonine kinases that phosphorylate acidic proteins such as caseins. The encoded kinase plays a role in cell cycle checkpoint arrest in response to stalled replication forks by phosphorylating Claspin. A mutation in this gene may be associated with non-syndromic early-onset epilepsy (NSEOE). [provided by RefSeq, Jul 2016]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.74 kDa
• AA Sequence: KKGYTFDYAYDWVGRPIPTPVGSVHVDSGASAITRESHTHRDRPSQQQPLRNQVVSSTNGELNVDDPTGAHSNAPITAHAEVEVVEEAKCCCFFKRKRKKT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CSNK1G1 casein kinase 1, gamma 1 [ Homo sapiens ]
• Official Symbol: CSNK1G1
• Synonyms: CSNK1G1; casein kinase 1, gamma 1; casein kinase I isoform gamma-1; CK1gamma1; CKI-gamma 1
• Gene ID: 53944
• mRNA Refseq: NM_022048
• Protein Refseq: NP_071331
• MIM: 606274
• UniProt ID: Q9HCP0