Recombinant Human CSN2 Protein, His-tagged

• Cat.No.: CSN2-194H
• Product Overview: Recombinant Human CSN2 fused with His tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: Important role in determination of the surface properties of the casein micelles.
• Form: Lyophilized from a 0.2 µM filtered solution of PBS,pH 7.4
• Molecular Mass: 24.3kD
• AA Sequence: MNHKVHHHHHHMEESITEYKQKVEKVKHEDQQQGEDEHQDKIYPSFQPQPLIYPFVEPIPYGFLPQNILPLAQPAVVLPVPQPEIMEVPKAKDTVYTKGRVMPVLKSPTIPFFDPQIPKLTDLENLHLPLPLLQPLMQQVPQPIPQTLALPPQPLWSVPQPKVLPIPQQVVPYPQRAVPVQALLLNQELLLNPTHQIYPVTQPLAPVHNPISV
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: CSN2 casein beta [ Homo sapiens ]
• Official Symbol: CSN2
• Synonyms: CSN2; casein beta; CASB; beta-casein
• Gene ID: 1447
• mRNA Refseq: NM_001891
• Protein Refseq: NP_001882
• MIM: 115460
• UniProt ID: P05814