Recombinant Human CSH1 Protein, GST-tagged

• Cat.No.: CSH1-1976H
• Product Overview: Human CSH1 full-length ORF ( AAH02717, 1 a.a. - 217 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. The gene is located at the growth hormone locus on chromosome 17 along with four other related genes in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. Although the five genes share a remarkably high degree of sequence identity, they are expressed selectively in different tissues. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed mainly in the placenta and utilizes multiple transcription initiation sites. Expression of the identical mature proteins for chorionic somatomammotropin hormones 1 and 2 is upregulated during development, although the ratio of 1 to 2 increases by term. Mutations in this gene result in placental lactogen deficiency and Silver-Russell syndrome. [provided by RefSeq, Jul 2008]
• Molecular Mass: 49.61 kDa
• AA Sequence: MAPGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSSCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDTDKVETFLRMVQCRSVEGSCGF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CSH1 chorionic somatomammotropin hormone 1 (placental lactogen) [ Homo sapiens ]
• Official Symbol: CSH1
• Synonyms: CSH1; chorionic somatomammotropin hormone 1 (placental lactogen); chorionic somatomammotropin hormone; choriomammotropin; chorionic somatomammotropin A; CSA; CSMT; FLJ75407; hCS A; PL; placental lactogen; CS-1; hCS-A
• Gene ID: 1442
• mRNA Refseq: NM_001317
• Protein Refseq: NP_001308
• MIM: 150200
• UniProt ID: P01243