Recombinant Human CSF3 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CSF3-1757H
Product Overview : CSF3 MS Standard C13 and N15-labeled recombinant protein (NP_757374) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the IL-6 superfamily of cytokines. The encoded cytokine controls the production, differentiation, and function of granulocytes. Granulocytes are a type of white blood cell that are part of the innate immune response. A modified form of this protein is commonly administered to manage chemotherapy-induced neutropenia. Alternatively spliced transcript variants have been described for this gene.
Molecular Mass : 21.5 kDa
AA Sequence : MSPEPALSPALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CSF3 colony stimulating factor 3 [ Homo sapiens (human) ]
Official Symbol CSF3
Synonyms CSF3; colony stimulating factor 3 (granulocyte); C17orf33, chromosome 17 open reading frame 33, G CSF, GCSF; granulocyte colony-stimulating factor; filgrastim; granulocyte colony stimulating factor; lenograstim; MGC45931; pluripoietin; GCSF; CSF3OS; C17orf33;
Gene ID 1440
mRNA Refseq NM_172220
Protein Refseq NP_757374
MIM 138970
UniProt ID P09919

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All CSF3 Products

Required fields are marked with *

My Review for All CSF3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon