Recombinant Human CSF2RA Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CSF2RA-5499H
• Product Overview: CSF2RA MS Standard C13 and N15-labeled recombinant protein (NP_758450) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: The protein encoded by this gene is the alpha subunit of the heterodimeric receptor for colony stimulating factor 2, a cytokine which controls the production, differentiation, and function of granulocytes and macrophages. The encoded protein is a member of the cytokine family of receptors. This gene is found in the pseudoautosomal region (PAR) of the X and Y chromosomes. Multiple transcript variants encoding different isoforms have been found for this gene, with some of the isoforms being membrane-bound and others being soluble.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 36.3 kDa
• AA Sequence: MLLLVTSLLLCELPHPAFLLIPEKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSLGYSGCSRQFHRSKTNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CSF2RA colony stimulating factor 2 receptor subunit alpha [ Homo sapiens (human) ]
• Official Symbol: CSF2RA
• Synonyms: CSF2RA; colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage); CSF2R; granulocyte-macrophage colony-stimulating factor receptor subunit alpha; CD116; GMR-alpha; GMCSFR-alpha; CD116 antigen; GM-CSF receptor alpha subunit; colony stimulating factor 2 receptor alpha subunit; granulocyte-macrophage colony-stimulating factor receptor alpha chain; GMR; SMDP4; CDw116; CSF2RX; CSF2RY; GMCSFR; CSF2RAX; CSF2RAY; MGC3848; MGC4838; GM-CSF-R-alpha
• Gene ID: 1438
• mRNA Refseq: NM_172247
• Protein Refseq: NP_758450
• MIM: 306250
• UniProt ID: P15509