Recombinant Human CRYGC Protein, GST-tagged

• Cat.No.: CRYGC-1939H
• Product Overview: Human CRYGC partial ORF ( NP_066269, 75 a.a. - 174 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the beta/gamma-crystallin family of proteins. Crystallins constitute the major proteins of vertebrate eye lens and maintain the transparency and refractive index of the lens. This gene and several family members are present in a gene cluster on chromosome 2. Mutations in this gene have been shown to cause multiple types of cataract, including Coppock-like cataract and zonular pulverulent cataract, among others. [provided by RefSeq, Jan 2015]
• Molecular Mass: 36.74 kDa
• AA Sequence: SIRSCCLIPQTVSHRLRLYEREDHKGLMMELSEDCPSIQDRFHLSEIRSLHVLEGCWVLYELPNYRGRQYLLRPQEYRRCQDWGAMDAKAGSLRRVVDLY
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CRYGC crystallin, gamma C [ Homo sapiens ]
• Official Symbol: CRYGC
• Synonyms: CRYGC; crystallin, gamma C; CRYG3; gamma-crystallin C; gamma-C-crystallin; gamma-crystallin 3; crystallin, gamma-3; gamma-crystallin 2-1; CCL
• Gene ID: 1420
• mRNA Refseq: NM_020989
• Protein Refseq: NP_066269
• MIM: 123680
• UniProt ID: P07315