Recombinant Human CRYBA2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CRYBA2-6666H
• Product Overview: CRYBA2 MS Standard C13 and N15-labeled recombinant protein (NP_005200) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of the vertebrate eye, which function to maintain the transparency and refractive index of the lens. Since lens central fiber cells lose their nuclei during development, these crystallins are made and then retained throughout life, making them extremely stable proteins. Mammalian lens crystallins are divided into alpha, beta, and gamma families; beta and gamma crystallins are also defined as a superfamily. Alpha and beta families are further divided into acidic and basic groups. Seven protein regions exist in crystallins: four homologous motifs, a connecting peptide, and N- and C-terminal extensions. Beta-crystallins, the most heterogeneous, differ by the presence of the C-terminal extension (present in the basic group but absent in the acidic group). Beta-crystallins form aggregates of different sizes and are able to form homodimers through self-association or heterodimers with other beta-crystallins. This gene is a beta acidic group member. Three alternatively spliced transcript variants encoding identical proteins have been reported.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 22.1 kDa
• AA Sequence: MSSAPAPGPAPASLTLWDEEDFQGRRCRLLSDCANVCERGGLPRVRSVKVENGVWVAFEYPDFQGQQFILEKGDYPRWSAWSGSSSHNSNQLLSFRPVLCANHNDSRVTLFEGDNFQGCKFDLVDDYPSLPSMGWASKDVGSLKVSSGAWVAYQYPGYRGYQYVLERDRHSGEFCTYGELGTQAHTGQLQSIRRVQHTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CRYBA2 crystallin beta A2 [ Homo sapiens (human) ]
• Official Symbol: CRYBA2
• Synonyms: CRYBA2; crystallin, beta A2; beta-crystallin A2; eye lens structural protein
• Gene ID: 1412
• mRNA Refseq: NM_005209
• Protein Refseq: NP_005200
• MIM: 600836
• UniProt ID: P53672