Recombinant Human CRYAA Protein
Cat.No. : | CRYAA-001H |
Product Overview : | Recombinant human CRYAA protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 173 |
Description : | Mammalian lens crystallins are divided into alpha, beta, and gamma families. Alpha crystallins are composed of two gene products: alpha-A and alpha-B, for acidic and basic, respectively. Alpha crystallins can be induced by heat shock and are members of the small heat shock protein (HSP20) family. They act as molecular chaperones although they do not renature proteins and release them in the fashion of a true chaperone; instead they hold them in large soluble aggregates. Post-translational modifications decrease the ability to chaperone. These heterogeneous aggregates consist of 30-40 subunits; the alpha-A and alpha-B subunits have a 3:1 ratio, respectively. Two additional functions of alpha crystallins are an autokinase activity and participation in the intracellular architecture. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. Alpha-A and alpha-B gene products are differentially expressed; alpha-A is preferentially restricted to the lens and alpha-B is expressed widely in many tissues and organs. Defects in this gene cause autosomal dominant congenital cataract (ADCC). |
Form : | Solution |
Molecular Mass : | 19.9 kDa |
AA Sequence : | MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS |
Purity : | > 95% |
Applications : | WB |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | 4°C |
Concentration : | 1 mg/mL |
Storage Buffer : | Tris-HCl (pH 7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | CRYAA crystallin, alpha A [ Homo sapiens (human) ] |
Official Symbol | CRYAA |
Synonyms | CRYAA; crystallin, alpha A; CRYA1; alpha-crystallin A chain; HSPB4; crystallin, alpha-1; heat shock protein beta-4; human alphaA-crystallin (CRYA1); |
Gene ID | 1409 |
mRNA Refseq | NM_000394 |
Protein Refseq | NP_000385 |
MIM | 123580 |
UniProt ID | P02489 |
◆ Recombinant Proteins | ||
CRYAA-1133HFL | Recombinant Full Length Human CRYAA Protein, C-Flag-tagged | +Inquiry |
CRYAA-001H | Recombinant Human CRYAA Protein | +Inquiry |
CRYAA-5488H | Recombinant Human CRYAA protein, His-tagged | +Inquiry |
CRYAA-2127HF | Recombinant Full Length Human CRYAA Protein, GST-tagged | +Inquiry |
CRYAA-26991TH | Recombinant Human CRYAA, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRYAA-7267HCL | Recombinant Human CRYAA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CRYAA Products
Required fields are marked with *
My Review for All CRYAA Products
Required fields are marked with *
0
Inquiry Basket