Recombinant Human CRTAM Protein, C-His-tagged
Cat.No. : | CRTAM-119H |
Product Overview : | Recombinant Human CRTAM Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | CD355, mediates heterophilic cell-cell adhesion which regulates the activation, differentiation and tissue retention of various T-cell subsets. Interaction with CADM1 promotes natural killer (NK) cell cytotoxicity and IFNG/interferon-gamma secretion by CD8+ T-cells in vitro as well as NK cell-mediated rejection of tumors expressing CADM1 in vivo. Regulates CD8+ T-cell proliferation in response to T-cell receptor (TCR) activation. Appears to be dispensable for CD8+ T-cell-mediated cytotoxicity. Interaction with SCRIB promotes the late phase of cellular polarization of a subset of CD4+ T-cells, which in turn regulates TCR-mediated proliferation and IFNG, IL17 and IL22 production. By interacting with CADM1 on CD8+ dendritic cells, regulates the retention of activated CD8+ T-cells within the draining lymph node (By similarity). Required for the intestinal retention of intraepithelial CD4+ CD8+ T-cells and, to a lesser extent, intraepithelial and lamina propria CD8+ T-cells and CD4+ T-cells (By similarity). Interaction with CADM1 promotes the adhesion to gut-associated CD103+ dendritic cells, which may facilitate the expression of gut-homing and adhesion molecules on T-cells and the conversion of CD4+ T-cells into CD4+ CD8+ T-cells (By similarity). |
Molecular Mass : | ~30 kDa |
AA Sequence : | SLTNHTETITVEEGQTLTLKCVTSLRKNSSLQWLTPSGFTIFLNEYPALKNSKYQLLHHSANQLSITVPNVTLQDEGVYKCLHYSDSVSTKEVKVIVLATPFKPILEASVIRKQNGEEHVVLMCSTMRSKPPPQITWLLGNSMEVSGGTLHEFETDGKKCNTTSTLIIHTYGKNSTVDCIIRHRGLQGRKLVAPFRFEDLVTDEETASDALERNSLSSQDPQQPTSTVSVTEDSSTSEIDKEEKEQTTQDPDLTTEANPQYLGLARKKSG |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | CRTAM cytotoxic and regulatory T cell molecule [ Homo sapiens (human) ] |
Official Symbol | CRTAM |
Synonyms | CRTAM; cytotoxic and regulatory T cell molecule; cytotoxic and regulatory T-cell molecule; CD355; class I MHC restricted T cell associated molecule; class-I MHC-restricted T cell associated molecule; class-I MHC-restricted T-cell-associated molecule; |
Gene ID | 56253 |
mRNA Refseq | NM_019604 |
Protein Refseq | NP_062550 |
MIM | 612597 |
UniProt ID | O95727 |
◆ Recombinant Proteins | ||
Crtam-23M | Recombinant Mouse Crtam Protein, His (Fc)-Avi-tagged | +Inquiry |
CRTAM-2164H | Recombinant Human CRTAM Protein (Ser18-Ser286), C-His tagged | +Inquiry |
CRTAM-2120HF | Recombinant Full Length Human CRTAM Protein, GST-tagged | +Inquiry |
CRTAM-1784R | Recombinant Rhesus Monkey CRTAM Protein, hIgG4-tagged | +Inquiry |
CRTAM-5015H | Recombinant Human CRTAM Protein (Met1-Ser286), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRTAM-2216HCL | Recombinant Human CRTAM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CRTAM Products
Required fields are marked with *
My Review for All CRTAM Products
Required fields are marked with *
0
Inquiry Basket