Recombinant Human CROT Protein (1-87 aa), GST-tagged

• Cat.No.: CROT-2122H
• Product Overview: Recombinant Human CROT Protein (1-87 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Tags & Cell Markers. Protein Description: Full Length of Isoform 2.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-87 aa
• Description: Beta-oxidation of fatty acids. The highest activity concerns the C6 to C10 chain length substrate. Converts the end product of pristanic acid beta oxidation, 4,8-dimethylnonanoyl-CoA, to its corresponding carnitine ester.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 37.2 kDa
• AA Sequence: MENQLAKSTEERTFQYQDSLPSLPVPSLEESLKKYLESVKPFANQEEYKKTEEIVQKFQSGIGEKLHQKLLERAKGKRNWVFVVIIE
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: CROT carnitine O-octanoyltransferase [ Homo sapiens ]
• Official Symbol: CROT
• Synonyms: CROT; carnitine O-octanoyltransferase; COT
• Gene ID: 54677
• mRNA Refseq: NM_001143935
• Protein Refseq: NP_001137407
• MIM: 606090
• UniProt ID: Q9UKG9