Recombinant Human CRIP1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | CRIP1-3776H |
Product Overview : | CRIP1 MS Standard C13 and N15-labeled recombinant protein (NP_001302) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Cysteine-rich intestinal protein (CRIP) belongs to the LIM/double zinc finger protein family, members of which include cysteine- and glycine-rich protein-1 (CSRP1), rhombotin-1 (RBTN1), rhombotin-2 (RBTN2), and rhombotin-3 (RBTN3). CRIP may be involved in intestinal zinc transport. |
Molecular Mass : | 8.5 kDa |
AA Sequence : | MPKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGGAESHTFKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CRIP1 cysteine rich protein 1 [ Homo sapiens (human) ] |
Official Symbol | CRIP1 |
Synonyms | CRIP1; cysteine-rich protein 1 (intestinal); cysteine-rich protein 1; CRIP; cysteine-rich heart protein; cysteine-rich intestinal protein; CRHP; CRP1; CRP-1; FLJ40971; |
Gene ID | 1396 |
mRNA Refseq | NM_001311 |
Protein Refseq | NP_001302 |
MIM | 123875 |
UniProt ID | P50238 |
◆ Recombinant Proteins | ||
CRIP1-5451C | Recombinant Chicken CRIP1 | +Inquiry |
CRIP1-7426Z | Recombinant Zebrafish CRIP1 | +Inquiry |
CRIP1-1256R | Recombinant Rat CRIP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CRIP1-1029R | Recombinant Rhesus monkey CRIP1 Protein, His-tagged | +Inquiry |
CRIP1-189H | Recombinant Human CRIP1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRIP1-200HCL | Recombinant Human CRIP1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CRIP1 Products
Required fields are marked with *
My Review for All CRIP1 Products
Required fields are marked with *
0
Inquiry Basket