Recombinant Human CRELD1 Protein, GST-tagged

• Cat.No.: CRELD1-1860H
• Product Overview: Human CRELD1 partial ORF ( NP_056328.2, 245 a.a. - 344 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a member of a subfamily of epidermal growth factor-related proteins. The encoded protein is characterized by a cysteine-rich with epidermal growth factor-like domain. This protein may function as a cell adhesion molecule. Mutations in this gene are the cause of atrioventricular septal defect. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Apr 2010]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 36.74 kDa
• AA Sequence: DIDECGTEGANCGADQFCVNTEGSYECRDCAKACLGCMGAGPGRCKKCSPGYQQVGSKCLDVDECETEVCPGENKQCENTEGGYRCICAEGYKQMEGICV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CRELD1 cysteine rich with EGF like domains 1 [ Homo sapiens (human) ]
• Official Symbol: CRELD1
• Synonyms: CRELD1; cysteine rich with EGF like domains 1; Cysteine Rich With EGF Like Domains 1; CIRRIN; Cysteine-Rich With EGF-Like Domain Protein 1; Cysteine-Rich With EGF-Like Domains 1; Cysteine Rich With EGF-Like Domains 1; Atrioventricular Septal Defect 2; AVSD2; cysteine-rich with EGF-like domain protein 1
• Gene ID: 78987
• mRNA Refseq: NM_001031717
• Protein Refseq: NP_001026887
• MIM: 607170
• UniProt ID: Q96HD1