Recombinant Human CRABP1 protein, GST-tagged
Cat.No. : | CRABP1-2730H |
Product Overview : | Recombinant Human CRABP1 protein(P29762)(2-137aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 2-137aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 42.5 kDa |
AA Sequence : | PNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQFYIKTSTTVRTTEINFKVGEGFEEETVDGRKCRSLPTWENENKIHCTQTLLEGDGPKTYWTRELANDELILTFGADDVVCTRIYVRE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CRABP1 cellular retinoic acid binding protein 1 [ Homo sapiens ] |
Official Symbol | CRABP1 |
Synonyms | CRABP1; cellular retinoic acid binding protein 1; cellular retinoic acid binding protein 1 , RBP5; cellular retinoic acid-binding protein 1; CRABP; CRABP I; CRABPI; cellular retinoic acid-binding protein I; RBP5; CRABP-I; |
Gene ID | 1381 |
mRNA Refseq | NM_004378 |
Protein Refseq | NP_004369 |
MIM | 180230 |
UniProt ID | P29762 |
◆ Recombinant Proteins | ||
CRABP1-1828H | Recombinant Human CRABP1 Protein, GST-tagged | +Inquiry |
CRABP1-4996H | Recombinant Human CRABP1 protein, His-tagged | +Inquiry |
CRABP1-1583R | Recombinant Rat CRABP1 Protein | +Inquiry |
CRABP1-3875M | Recombinant Mouse CRABP1 Protein | +Inquiry |
CRABP1-3675H | Recombinant Human CRABP1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRABP1-197HCL | Recombinant Human CRABP1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CRABP1 Products
Required fields are marked with *
My Review for All CRABP1 Products
Required fields are marked with *
0
Inquiry Basket