Recombinant Human CRABP1 protein, GST-tagged

• Cat.No.: CRABP1-2730H
• Product Overview: Recombinant Human CRABP1 protein(P29762)(2-137aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 42.5 kDa
• Protein length: 2-137aa
• AA Sequence: PNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQFYIKTSTTVRTTEINFKVGEGFEEETVDGRKCRSLPTWENENKIHCTQTLLEGDGPKTYWTRELANDELILTFGADDVVCTRIYVRE
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: CRABP1 cellular retinoic acid binding protein 1 [ Homo sapiens ]
• Official Symbol: CRABP1
• Synonyms: CRABP1; cellular retinoic acid binding protein 1; cellular retinoic acid binding protein 1 , RBP5; cellular retinoic acid-binding protein 1; CRABP; CRABP I; CRABPI; cellular retinoic acid-binding protein I; RBP5; CRABP-I
• Gene ID: 1381
• mRNA Refseq: NM_004378
• Protein Refseq: NP_004369
• MIM: 180230
• UniProt ID: P29762