Recombinant Human CPT1A
Cat.No. : | CPT1A-26794TH |
Product Overview : | Recombinant fragment corresponding to amino acids 461-550 of Human CPT1A with an N terminal proprietary tag; Predicted MWt 35.53 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 90 amino acids |
Description : | The mitochondrial oxidation of long-chain fatty acids is initiated by the sequential action of carnitine palmitoyltransferase I (which is located in the outer membrane and is detergent-labile) and carnitine palmitoyltransferase II (which is located in the inner membrane and is detergent-stable), together with a carnitine-acylcarnitine translocase. CPT I is the key enzyme in the carnitine-dependent transport across the mitochondrial inner membrane and its deficiency results in a decreased rate of fatty acid beta-oxidation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Molecular Weight : | 35.530kDa inclusive of tags |
Tissue specificity : | Strong expression in kidney and heart, and lower in liver and skeletal muscle. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | VFKNGKMGLNAEHSWADAPIVAHLWEYVMSIDSLQLGYAEDGHCKGDINPNIPYPTRLQWDIPGECQEVIETSLNTANLLANDVDFHSFP |
Sequence Similarities : | Belongs to the carnitine/choline acetyltransferase family. |
Gene Name | CPT1A carnitine palmitoyltransferase 1A (liver) [ Homo sapiens ] |
Official Symbol | CPT1A |
Synonyms | CPT1A; carnitine palmitoyltransferase 1A (liver); CPT1; carnitine O-palmitoyltransferase 1, liver isoform; CPT1 L; L CPT1; |
Gene ID | 1374 |
mRNA Refseq | NM_001031847 |
Protein Refseq | NP_001027017 |
MIM | 600528 |
Uniprot ID | P50416 |
Chromosome Location | 11q13.2 |
Pathway | AMPK signaling, organism-specific biosystem; Adipocytokine signaling pathway, organism-specific biosystem; Adipocytokine signaling pathway, conserved biosystem; FOXA2 and FOXA3 transcription factor networks, organism-specific biosystem; Fatty Acid Beta Oxidation, organism-specific biosystem; |
Function | carnitine O-palmitoyltransferase activity; identical protein binding; transferase activity, transferring acyl groups; |
◆ Recombinant Proteins | ||
RFL10138MF | Recombinant Full Length Mouse Carnitine O-Palmitoyltransferase 1, Liver Isoform(Cpt1A) Protein, His-Tagged | +Inquiry |
CPT1A-5732H | Recombinant Human CPT1A protein, GST-tagged | +Inquiry |
CPT1A-1577R | Recombinant Rat CPT1A Protein | +Inquiry |
CPT1A-1234R | Recombinant Rat CPT1A Protein, His (Fc)-Avi-tagged | +Inquiry |
CPT1A-2228HF | Recombinant Full Length Human CPT1A Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CPT1A-7300HCL | Recombinant Human CPT1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CPT1A Products
Required fields are marked with *
My Review for All CPT1A Products
Required fields are marked with *
0
Inquiry Basket