Recombinant Human CPT1A

• Cat.No.: CPT1A-26794TH
• Product Overview: Recombinant fragment corresponding to amino acids 461-550 of Human CPT1A with an N terminal proprietary tag; Predicted MWt 35.53 kDa.

Specification

• Description: The mitochondrial oxidation of long-chain fatty acids is initiated by the sequential action of carnitine palmitoyltransferase I (which is located in the outer membrane and is detergent-labile) and carnitine palmitoyltransferase II (which is located in the inner membrane and is detergent-stable), together with a carnitine-acylcarnitine translocase. CPT I is the key enzyme in the carnitine-dependent transport across the mitochondrial inner membrane and its deficiency results in a decreased rate of fatty acid beta-oxidation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Protein length: 90 amino acids
• Molecular Weight: 35.530kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Strong expression in kidney and heart, and lower in liver and skeletal muscle.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: VFKNGKMGLNAEHSWADAPIVAHLWEYVMSIDSLQLGYAEDGHCKGDINPNIPYPTRLQWDIPGECQEVIETSLNTANLLANDVDFHSFP
• Sequence Similarities: Belongs to the carnitine/choline acetyltransferase family.
• Tag: Non

Gene Information

• Gene Name: CPT1A carnitine palmitoyltransferase 1A (liver) [ Homo sapiens ]
• Official Symbol: CPT1A
• Synonyms: CPT1A; carnitine palmitoyltransferase 1A (liver); CPT1; carnitine O-palmitoyltransferase 1, liver isoform; CPT1 L; L CPT1
• Gene ID: 1374
• mRNA Refseq: NM_001031847
• Protein Refseq: NP_001027017
• MIM: 600528
• Uniprot ID: P50416
• Chromosome Location: 11q13.2
• Pathway: AMPK signaling, organism-specific biosystem; Adipocytokine signaling pathway, organism-specific biosystem; Adipocytokine signaling pathway, conserved biosystem; FOXA2 and FOXA3 transcription factor networks, organism-specific biosystem; Fatty Acid Beta Oxidation, organism-specific biosystem
• Function: carnitine O-palmitoyltransferase activity; identical protein binding; transferase activity, transferring acyl groups