Recombinant Human COX7C Protein, GST-tagged

Cat.No. : COX7C-1764H
Product Overview : Human COX7C full-length ORF ( AAH07498, 1 a.a. - 63 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes subunit VIIc, which shares 87% and 85% amino acid sequence identity with mouse and bovine COX VIIc, respectively, and is found in all tissues. A pseudogene COX7CP1 has been found on chromosome 13. [provided by RefSeq, Jul 2008]
Molecular Mass : 32.56 kDa
AA Sequence : MLGQSIRRFTTSVVRRSHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQLLKT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name COX7C cytochrome c oxidase subunit VIIc [ Homo sapiens ]
Official Symbol COX7C
Synonyms COX7C; COX7C_HUMAN; Cytochrome c oxidase polypeptide VIIc; Cytochrome c oxidase subunit 7C; mitochondrial; cytochrome-c oxidase chain VIIc; Cytochrome c oxidase polypeptide VIIc
Gene ID 1350
mRNA Refseq NM_001867.2
Protein Refseq NP_001858.1
MIM 603774
UniProt ID P15954

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All COX7C Products

Required fields are marked with *

My Review for All COX7C Products

Required fields are marked with *

0

Inquiry Basket

cartIcon