Recombinant Human COX7C Protein, GST-tagged
Cat.No. : | COX7C-1764H |
Product Overview : | Human COX7C full-length ORF ( AAH07498, 1 a.a. - 63 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes subunit VIIc, which shares 87% and 85% amino acid sequence identity with mouse and bovine COX VIIc, respectively, and is found in all tissues. A pseudogene COX7CP1 has been found on chromosome 13. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 32.56 kDa |
AA Sequence : | MLGQSIRRFTTSVVRRSHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQLLKT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | COX7C cytochrome c oxidase subunit VIIc [ Homo sapiens ] |
Official Symbol | COX7C |
Synonyms | COX7C; COX7C_HUMAN; Cytochrome c oxidase polypeptide VIIc; Cytochrome c oxidase subunit 7C; mitochondrial; cytochrome-c oxidase chain VIIc; Cytochrome c oxidase polypeptide VIIc |
Gene ID | 1350 |
mRNA Refseq | NM_001867.2 |
Protein Refseq | NP_001858.1 |
MIM | 603774 |
UniProt ID | P15954 |
◆ Recombinant Proteins | ||
COX7C-10357Z | Recombinant Zebrafish COX7C | +Inquiry |
Cox7c-930M | Recombinant Mouse Cox7c Protein, MYC/DDK-tagged | +Inquiry |
COX7C-1215R | Recombinant Rat COX7C Protein, His (Fc)-Avi-tagged | +Inquiry |
COX7C-1558R | Recombinant Rat COX7C Protein | +Inquiry |
COX7C-824R | Recombinant Rhesus Macaque COX7C Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COX7C-7323HCL | Recombinant Human COX7C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COX7C Products
Required fields are marked with *
My Review for All COX7C Products
Required fields are marked with *
0
Inquiry Basket