Recombinant Human COX6B1

• Cat.No.: COX6B1-27556TH
• Product Overview: Recombinant full length Human COX6B1 with N-terminal proprietary tag. Predicted MW 35.20kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 87 amino acids
• Description: Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIb. Mutations in this gene are associated with severe infantile encephalomyopathy. Three pseudogenes COX6BP-1, COX6BP-2 and COX6BP-3 have been found on chromosomes 7, 17 and 22q13.1-13.2, respectively.
• Molecular Weight: 35.200kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI
• Sequence Similarities: Belongs to the cytochrome c oxidase subunit 6B family.

Gene Information

• Gene Name: COX6B1 cytochrome c oxidase subunit VIb polypeptide 1 (ubiquitous) [ Homo sapiens ]
• Official Symbol: COX6B1
• Synonyms: COX6B1; cytochrome c oxidase subunit VIb polypeptide 1 (ubiquitous); COX6B, cytochrome c oxidase subunit Vib , cytochrome c oxidase subunit Vib polypeptide 1 (ubiquitous); cytochrome c oxidase subunit 6B1; COXG
• Gene ID: 1340
• mRNA Refseq: NM_001863
• Protein Refseq: NP_001854
• MIM: 124089
• Uniprot ID: P14854
• Chromosome Location: 19q13.1
• Pathway: Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Cardiac muscle contraction, organism-specific biosystem; Cardiac muscle contraction, conserved biosystem; Cytochrome c oxidase, organism-specific biosystem
• Function: cytochrome-c oxidase activity