Recombinant Human COX4NB, His-tagged

• Cat.No.: COX4NB-26363TH
• Product Overview: Recombinant full length Human COX4NB with an N terminal His tag; 230aa, 25.9kDa inclusive of tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 210 amino acids
• Description: Neighbor of COX4 (COX4NB) belongs to the UPF0172 (NOC4) family. It is expressed in liver, pancreas, heart, lung, kidney, brain, skeletal muscle, and placenta. Expression levels are highest in pancreas and moderate in heart, skeletal muscle, and placenta.
• Conjugation: HIS
• Molecular Weight: 25.900kDa inclusive of tags
• Tissue specificity: Expressed in liver, pancreas, heart, lung, kidney, brain, skeletal muscle, and placenta. Expression levels are highest in pancreas and moderate in heart, skeletal muscle, and placenta.
• Form: Liquid
• Purity: >95% by SDS-PAGE
• Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 0.02% DTT, 10% Glycerol, 0.58% Sodium chloride
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMPGVKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVDCIPLFHGTLALAPMLEVALTLIDSWCKDHSYVIAGYYQANERVKDASPNQVAEKVASRIAEGFSDTALIMVDNTKFTMDCVAPTIHVYEHHENRWRCRDPHHDYCEDWPEAQRISASLLDSRSYETLVDFDNHLDDIRNDWTNPEINKAVLHLC
• Sequence Similarities: Belongs to the UPF0172 (NOC4) family.

Gene Information

• Gene Name: COX4NB COX4 neighbor [ Homo sapiens ]
• Official Symbol: COX4NB
• Synonyms: COX4NB; COX4 neighbor; C16orf2, C16orf4, chromosome 16 open reading frame 2 , chromosome 16 open reading frame 4 , neighbor of COX4 , NOC4; neighbor of COX4; FAM158B; family with sequence similarity 158; member B
• Gene ID: 10328
• mRNA Refseq: NM_001142288
• Protein Refseq: NP_001135760
• MIM: 604886
• Uniprot ID: O43402
• Chromosome Location: 16q24