Recombinant Human COX4I2 Protein, GST-tagged

• Cat.No.: COX4I2-1744H
• Product Overview: Human COX4I2 full-length ORF ( AAH57779, 1 a.a. - 171 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes isoform 2 of subunit IV. Isoform 1 of subunit IV is encoded by a different gene, however, the two genes show a similar structural organization. Subunit IV is the largest nuclear encoded subunit which plays a pivotal role in COX regulation. [provided by RefSeq, Jul 2008]
• Molecular Mass: 44.55 kDa
• AA Sequence: MLPRAAWSLVLRKGGGGRRGMHSSEGTTRGGGKMSPYTNCYAQRYYPMPEEPFCTELNAEEQALKEKEKGSWTQLTHAEKVALYRLQFNETFAEMNRRSNEWKTVMGCVFFFIGFAALVIWWQRVYVFPPKPITLTDERKAQQLQRMLDMKVNPVQGLASRWDYEKKQWKK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: COX4I2 cytochrome c oxidase subunit IV isoform 2 (lung) [ Homo sapiens ]
• Official Symbol: COX4I2
• Synonyms: COX4I2; cytochrome c oxidase subunit IV isoform 2 (lung); COX4L2, cytochrome c oxidase subunit IV isoform 2; cytochrome c oxidase subunit 4 isoform 2, mitochondrial; COX4 2; COX4B; COXIV 2; cytochrome c oxidase subunit IV like 2; dJ857M17.2; COX IV-2; cytochrome c oxidase subunit IV-like 2; COX4; COX4-2; COX4L2; COXIV-2
• Gene ID: 84701
• mRNA Refseq: NM_032609
• Protein Refseq: NP_115998
• MIM: 607976
• UniProt ID: Q96KJ9