Recombinant Human COX20 Protein, GST-tagged

• Cat.No.: COX20-1741H
• Product Overview: Human COX20 full-length ORF (BAG54176.1, 1 a.a. - 118 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a protein that plays a role in the assembly of cytochrome C oxidase, an important component of the respiratory pathway. It contains two transmembrane helices and localizes to the mitochondrial membrane. Mutations in this gene can cause mitochondrial complex IV deficiency, which results in ataxia and muscle hypotonia. There are multiple pseudogenes for this gene. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2015]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 39.7 kDa
• AA Sequence: MAAPPEPGEPEERKSLKLLGFLDVENTPCARHSILYGSLGSVVAGFGHFLFTSRIRRSCDVGVGGFILVTLGCWFHCRYNYAKQRIQERIAREEIKKKILYEGTHLDPERKHNGSSSN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: COX20 COX20 Cox2 chaperone homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: COX20
• Synonyms: FAM36A
• Gene ID: 116228
• mRNA Refseq: NM_198076.4
• Protein Refseq: NP_932342.1
• MIM: 614698
• UniProt ID: Q5RI15