Recombinant Human COPS2 protein, GST-tagged

• Cat.No.: COPS2-25H
• Product Overview: Recombinant Human COPS2(1-443aa) fused with with GST Tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-443 a.a.
• Description: Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 300 mM Imidazole, pH 8.0). Trehalose (5-8%) and mannitol (5-8%) protectants were added before lyophilization.
• AA Sequence: MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELEGEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQAVVSKLA
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Stability and Storage: Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder.
  Storage of Reconstituted Protein: Short-term storage: Store at 2-8 centigrade for two weeks.
  Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
  If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
  Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.

Gene Information

• Gene Name: COPS2 COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis) [ Homo sapiens ]
• Official Symbol: COPS2
• Synonyms: COPS2; COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis); COP9 signalosome complex subunit 2; ALIEN; CSN2; TRIP15; TRIP-15; alien homolog; signalosome subunit 2; TR-interacting protein 15; JAB1-containing signalosome subunit 2; thyroid receptor interacting protein 15; thyroid receptor-interacting protein 15; SGN2
• Gene ID: 9318
• mRNA Refseq: NM_001143887
• Protein Refseq: NP_001137359
• MIM: 604508
• UniProt ID: P61201
• Chromosome Location: 15q21.2
• Function: protein binding; signal transducer activity