Recombinant Human COPB1 Protein, GST-tagged

• Cat.No.: COPB1-1692H
• Product Overview: Human COPB partial ORF ( NP_057535, 854 a.a. - 953 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a protein subunit of the coatomer complex associated with non-clathrin coated vesicles. The coatomer complex, also known as the coat protein complex 1, forms in the cytoplasm and is recruited to the Golgi by activated guanosine triphosphatases. Once at the Golgi membrane, the coatomer complex may assist in the movement of protein and lipid components back to the endoplasmic reticulum. Alternatively spliced transcript variants have been described. [provided by RefSeq, Jan 2009]
• Molecular Mass: 36.74 kDa
• AA Sequence: TVNTNMVDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIEKPIHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQKKTSI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: COPB1 coatomer protein complex, subunit beta 1 [ Homo sapiens ]
• Official Symbol: COPB1
• Synonyms: COPB1; coatomer protein complex, subunit beta 1; coatomer protein complex, subunit beta , COPB; coatomer subunit beta; beta-cop; beta coat protein; beta-coat protein; COPB; FLJ10341; FLJ46444; FLJ57957; DKFZp761K102
• Gene ID: 1315
• mRNA Refseq: NM_001144061
• Protein Refseq: NP_001137533
• MIM: 600959
• UniProt ID: P53618