Recombinant Human COMMD9 Protein, GST-tagged

Cat.No. : COMMD9-1686H
Product Overview : Human COMMD9 full-length ORF ( AAH10892.1, 1 a.a. - 198 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : COMMD9 (COMM Domain Containing 9) is a Protein Coding gene. Among its related pathways are Innate Immune System.
Molecular Mass : 48.2 kDa
AA Sequence : MAALTAEHFAALQSLLKASSKDVVRQLCQESFSSSALGLKKLLDVTCSSLSVTQEEAEELLQALHRLTRLVAFRDLSSAEAILALFPENFHQNLKNLLTKIILEHVSTWRTEAQANQISLPRLVDLDWRVDIKTSSDSISRMAVPTCLLQMKIQEDPSLCGDKPSISAVTVELSKETLDTMLDGLGRIRDQLSAVASK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name COMMD9 COMM domain containing 9 [ Homo sapiens ]
Official Symbol COMMD9
Synonyms HSPC166
Gene ID 29099
mRNA Refseq NM_014186.3
Protein Refseq NP_054905.2
MIM 612299
UniProt ID Q9P000

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All COMMD9 Products

Required fields are marked with *

My Review for All COMMD9 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon