Recombinant Human COMMD6 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | COMMD6-5908H |
Product Overview : | COMMD6 MS Standard C13 and N15-labeled recombinant protein (NP_987091) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Description : | COMMD6 belongs to a family of NF-kappa-B (see RELA)-inhibiting proteins characterized by the presence of a COMM domain. |
Source : | HEK293 |
Species : | Human |
Tag : | Myc&DDK |
Molecular Mass : | 9.6 kDa |
AA Sequence : | MEASSEPPLDAKSDVTNQLVDFQWKLGMAVSSDTCRSLKYPYVAVMLKVADHSGQVKTKCFEMTIPQFQNFYRQFKEIAAVIETVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | COMMD6 COMM domain containing 6 [ Homo sapiens (human) ] |
Official Symbol | COMMD6 |
Synonyms | COMMD6; COMM domain containing 6; Acrg; COMM domain-containing protein 6; Acrg embryonic lethality minimal region ortholog |
Gene ID | 170622 |
mRNA Refseq | NM_203495 |
Protein Refseq | NP_987091 |
MIM | 612377 |
UniProt ID | Q7Z4G1 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All COMMD6 Products
Required fields are marked with *
My Review for All COMMD6 Products
Required fields are marked with *
0
Inquiry Basket