Recombinant Human COMMD6 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : COMMD6-5908H
Product Overview : COMMD6 MS Standard C13 and N15-labeled recombinant protein (NP_987091) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : COMMD6 belongs to a family of NF-kappa-B (see RELA)-inhibiting proteins characterized by the presence of a COMM domain.
Source : HEK293
Species : Human
Tag : Myc&DDK
Molecular Mass : 9.6 kDa
AA Sequence : MEASSEPPLDAKSDVTNQLVDFQWKLGMAVSSDTCRSLKYPYVAVMLKVADHSGQVKTKCFEMTIPQFQNFYRQFKEIAAVIETVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name COMMD6 COMM domain containing 6 [ Homo sapiens (human) ]
Official Symbol COMMD6
Synonyms COMMD6; COMM domain containing 6; Acrg; COMM domain-containing protein 6; Acrg embryonic lethality minimal region ortholog
Gene ID 170622
mRNA Refseq NM_203495
Protein Refseq NP_987091
MIM 612377
UniProt ID Q7Z4G1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All COMMD6 Products

Required fields are marked with *

My Review for All COMMD6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon