Recombinant Human COMMD3 Protein, GST-tagged

• Cat.No.: COMMD3-1678H
• Product Overview: Human COMMD3 full-length ORF ( AAH22898, 1 a.a. - 195 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: COMMD3 (COMM Domain Containing 3) is a Protein Coding gene. Diseases associated with COMMD3 include Tarsal Tunnel Syndrome and Tibial Neuropathy. Among its related pathways are Innate Immune System.
• Molecular Mass: 46.97 kDa
• AA Sequence: MELSESVQKGFQMLADPRSFDSNAFTLLLRAAFQSLLDAQADEAVLDHPDLKHIDPVVLKHCHAAAATYILEAGKHRADKSTLSTYLEDCKFDRERIELFCTEYQNNKNSLEILLGSIGRSLPHITDVSWRLEYQIKTNQLHRMYRPAYLVTLSVQNTDSPSYPEISFSCSMEQLQDLVGKLKDASKSLERATQS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: COMMD3 COMM domain containing 3 [ Homo sapiens ]
• Official Symbol: COMMD3
• Synonyms: COMMD3; COMM domain containing 3; C10orf8, chromosome 10 open reading frame 8; COMM domain-containing protein 3; BUP; protein Bup; C10orf8; FLJ45471; DKFZp686K0399
• Gene ID: 23412
• mRNA Refseq: NM_012071
• Protein Refseq: NP_036203
• MIM: 616700
• UniProt ID: Q9UBI1