Recombinant Human COLEC11 Protein, GST-tagged
Cat.No. : | COLEC11-1668H |
Product Overview : | Human COLEC11 full-length ORF ( NP_076932.1, 1 a.a. - 271 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the collectin family of C-type lectins that possess collagen-like sequences and carbohydrate recognition domains. Collectins are secreted proteins that play important roles in the innate immune system by binding to carbohydrate antigens on microorganisms, facilitating their recognition and removal. The encoded protein binds to multiple sugars with a preference for fucose and mannose. Mutations in this gene are a cause of 3MC syndrome-2. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011] |
Molecular Mass : | 55.1 kDa |
AA Sequence : | MRGNLALVGVLISLAFLSLLPSGHPQPAGDDACSVQILVPGLKGDAGEKGDKGAPGRPGRVGPTGEKGDMGDKGQKGSVGRHGKIGPIGSKGEKGDSGDIGPPGPNGEPGLPCECSQLRKAIGEMDNQVSQLTSELKFIKNAVAGVRETESKIYLLVKEEKRYADAQLSCQGRGGTLSMPKDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKENM |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | COLEC11 collectin sub-family member 11 [ Homo sapiens ] |
Official Symbol | COLEC11 |
Synonyms | COLEC11; collectin sub-family member 11; MGC3279; |
Gene ID | 78989 |
mRNA Refseq | NM_001255982 |
Protein Refseq | NP_001242911 |
MIM | 612502 |
UniProt ID | Q9BWP8 |
◆ Recombinant Proteins | ||
COLEC11-3297H | Recombinant Human COLEC11 Protein, MYC/DDK-tagged | +Inquiry |
COLEC11-1721Z | Recombinant Zebrafish COLEC11 | +Inquiry |
COLEC11-2194HF | Recombinant Full Length Human COLEC11 Protein, GST-tagged | +Inquiry |
COLEC11-1393H | Active Recombinant Human CLK1, GST-tagged | +Inquiry |
COLEC11-1668H | Recombinant Human COLEC11 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COLEC11-001MCL | Recombinant Mouse COLEC11 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COLEC11 Products
Required fields are marked with *
My Review for All COLEC11 Products
Required fields are marked with *
0
Inquiry Basket