Recombinant Human COL6A2 protein(254-400aa), His-GST&Myc-tagged

• Cat.No.: COL6A2-532H
• Product Overview: Recombinant Human COL6A2 protein(P12110)(254-400aa), fused with N-terminal His and GST and C-terminal Myc tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST&His&Myc
• Protein Length: 254-400aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 35.2 kDa
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: IPGPSGPKGYRGQKGAKGNMGEPGEPGQKGRQGDPGIEGPIGFPGPKGVPGFKGEKGEFGADGRKGAPGLAGKNGTDGQKGKLGRIGPPGCKGDPGNRGPDGYPGEAGSPGERGDQGGKGDPGRPGRRGPPGEIGAKGSKGYQGNSG

Gene Information

• Gene Name: COL6A2 collagen, type VI, alpha 2 [ Homo sapiens ]
• Official Symbol: COL6A2
• Synonyms: COL6A2; collagen, type VI, alpha 2; collagen alpha-2(VI) chain; collagen VI, alpha-2 polypeptide; human mRNA for collagen VI alpha-2 C-terminal globular domain; PP3610; FLJ46862; DKFZp586E1322
• Gene ID: 1292
• mRNA Refseq: NM_001849
• Protein Refseq: NP_001840
• MIM: 120240
• UniProt ID: P12110