Recombinant Human COL23A1 Protein, GST-tagged

Cat.No. : COL23A1-1641H
Product Overview : Human COL23A1 full-length ORF ( AAH42428.1, 1 a.a. - 309 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : COL23A1 is a member of the transmembrane collagens, a subfamily of the nonfibrillar collagens that contain a single pass hydrophobic transmembrane domain (Banyard et al., 2003 [PubMed 12644459]).[supplied by OMIM, Mar 2008]
Molecular Mass : 57.1 kDa
AA Sequence : MESRSGIQAGVRCRDLGSLQPPPLALKQFSSLSLPSSWDYRRLPPRCGFLFEVSETTNPPAGTNSRHTLTVKLDGLAKIRTAREAPSECVCPPGPPGRRGKPGRRGDPGPPGPLGLDGKPGLPGPKGEKGAPGDFGPRGDQGQDGAAGPPGPPGPPGARGPPGDTGKDGPRGAQGPAGPKGEPGQDGEMGPKGPPGPKGEPGVPGKKGDDGTPSQPGPPGPKGEPGSMGPRGENGVDGAPGPKGEPGHRGTDGAAGPRGDVRDPGLGSVSSCSQRLASSSKKNGSEPPPGCAGCPRPQGRAGRHSGDRL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name COL23A1 collagen, type XXIII, alpha 1 [ Homo sapiens ]
Official Symbol COL23A1
Synonyms COL23A1; collagen, type XXIII, alpha 1; collagen alpha-1(XXIII) chain; DKFZp434K0621; procollagen, type XXIII, alpha 1;
Gene ID 91522
mRNA Refseq NM_173465
Protein Refseq NP_775736
MIM 610043
UniProt ID Q86Y22

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All COL23A1 Products

Required fields are marked with *

My Review for All COL23A1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon