Recombinant Human COL23A1 Protein, GST-tagged
Cat.No. : | COL23A1-1641H |
Product Overview : | Human COL23A1 full-length ORF ( AAH42428.1, 1 a.a. - 309 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | COL23A1 is a member of the transmembrane collagens, a subfamily of the nonfibrillar collagens that contain a single pass hydrophobic transmembrane domain (Banyard et al., 2003 [PubMed 12644459]).[supplied by OMIM, Mar 2008] |
Molecular Mass : | 57.1 kDa |
AA Sequence : | MESRSGIQAGVRCRDLGSLQPPPLALKQFSSLSLPSSWDYRRLPPRCGFLFEVSETTNPPAGTNSRHTLTVKLDGLAKIRTAREAPSECVCPPGPPGRRGKPGRRGDPGPPGPLGLDGKPGLPGPKGEKGAPGDFGPRGDQGQDGAAGPPGPPGPPGARGPPGDTGKDGPRGAQGPAGPKGEPGQDGEMGPKGPPGPKGEPGVPGKKGDDGTPSQPGPPGPKGEPGSMGPRGENGVDGAPGPKGEPGHRGTDGAAGPRGDVRDPGLGSVSSCSQRLASSSKKNGSEPPPGCAGCPRPQGRAGRHSGDRL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | COL23A1 collagen, type XXIII, alpha 1 [ Homo sapiens ] |
Official Symbol | COL23A1 |
Synonyms | COL23A1; collagen, type XXIII, alpha 1; collagen alpha-1(XXIII) chain; DKFZp434K0621; procollagen, type XXIII, alpha 1; |
Gene ID | 91522 |
mRNA Refseq | NM_173465 |
Protein Refseq | NP_775736 |
MIM | 610043 |
UniProt ID | Q86Y22 |
◆ Recombinant Proteins | ||
COL23A1-1857M | Recombinant Mouse COL23A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
COL23A1-1519R | Recombinant Rat COL23A1 Protein | +Inquiry |
COL23A1-3786H | Recombinant Human COL23A1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
COL23A1-2711H | Recombinant Human COL23A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
COL23A1-2095HF | Recombinant Full Length Human COL23A1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COL23A1-381HCL | Recombinant Human COL23A1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COL23A1 Products
Required fields are marked with *
My Review for All COL23A1 Products
Required fields are marked with *
0
Inquiry Basket