Recombinant Human COG6 Protein, GST-tagged
Cat.No. : | COG6-1629H |
Product Overview : | Human COG6 partial ORF ( NP_065802, 558 a.a. - 657 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a subunit of the conserved oligomeric Golgi complex that is required for maintaining normal structure and activity of the Golgi apparatus. The encoded protein is organized with conserved oligomeric Golgi complex components 5, 7 and 8 into a sub-complex referred to as lobe B. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Feb 2009] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | QQHKPEQGSLANMPNLDSVTLKAAMVQFDRYLSAPDNLLIPQLNFLLSATVKEQIVKQSTELVCRAYGEVYAAVMNPINEYKDPENILHRSPQQVQTLLS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | COG6 component of oligomeric golgi complex 6 [ Homo sapiens ] |
Official Symbol | COG6 |
Synonyms | COG6; component of oligomeric golgi complex 6; conserved oligomeric Golgi complex subunit 6; COD2; KIAA1134; COG complex subunit 6; complexed with Dor1p 2; conserved oligomeric Golgi complex protein 6; DKFZp313D191; |
Gene ID | 57511 |
mRNA Refseq | NM_001145079 |
Protein Refseq | NP_001138551 |
MIM | 606977 |
UniProt ID | Q9Y2V7 |
◆ Recombinant Proteins | ||
Cog6-2238M | Recombinant Mouse Cog6 Protein, Myc/DDK-tagged | +Inquiry |
COG6-1514R | Recombinant Rat COG6 Protein | +Inquiry |
COG6-3710M | Recombinant Mouse COG6 Protein | +Inquiry |
COG6-1843M | Recombinant Mouse COG6 Protein, His (Fc)-Avi-tagged | +Inquiry |
COG6-11420H | Recombinant Human COG6, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COG6-7383HCL | Recombinant Human COG6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COG6 Products
Required fields are marked with *
My Review for All COG6 Products
Required fields are marked with *
0
Inquiry Basket